PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009777871.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family bZIP
Protein Properties Length: 299aa    MW: 33583.8 Da    PI: 4.6155
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009777871.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_123.51.2e-07138179445
                     XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaL 45 
                     +k+ +r  +NR AA rsR+RKk ++  Le k+  +e+e k+L
  XP_009777871.1 138 DKKRKRQLRNRDAAVRSRERKKLYVRDLELKSRYFESECKRL 179
                     799***********************************9887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1703.6E-11132198No hitNo description
SMARTSM003382.8E-4135199IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.358137179IPR004827Basic-leucine zipper domain
PfamPF001703.3E-7138179IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.5E-9139196No hitNo description
CDDcd147044.04E-15140191No hitNo description
PROSITE patternPS000360142157IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010200Biological Processresponse to chitin
GO:0030968Biological Processendoplasmic reticulum unfolded protein response
GO:0005634Cellular Componentnucleus
GO:0005789Cellular Componentendoplasmic reticulum membrane
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    Send to blast
MVDDIDDIVG HINWDDVDDL FHNILEDPAD NLFSVHDPSA PSIQEIEQLL MNDDEIVGHV  60
AVGEPDFQLA DDFLSDVLAD SPVESDHSPS DKVNGFPDSK VSSSSEVDDD DKDKEKVSQS  120
PIESKDGSDE LNSDDPVDKK RKRQLRNRDA AVRSRERKKL YVRDLELKSR YFESECKRLG  180
LVLQCCLAEN QALRFSLQNG SANGACMTKQ ESAVLLLESL LLGSLLWFLG IICLLILPSQ  240
PWLNPEENQR SRNHGLLVPI KGGNKTGRIF EFLSFMMGKR CKASRSRMKF NPHSLGIVM
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1139158KRKRQLRNRDAAVRSRERKK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00019PBMTransfer from AT1G42990Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB2812710.0AB281271.1 Nicotiana tabacum NtbZIP60 mRNA for basic region leucine zipper protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009777871.10.0PREDICTED: bZIP transcription factor 60
RefseqXP_016492054.10.0PREDICTED: bZIP transcription factor 60-like
TrEMBLA7VKB40.0A7VKB4_TOBAC; Basic region leucine zipper protein
STRINGPGSC0003DMT4000259211e-130(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA71012128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G42990.15e-22basic region/leucine zipper motif 60